Scroll to Top of the page

Vemurafenib Structure

Nuestra colección de imágenes de Vemurafenib Structure. Para descargar o imprimir sólo tiene que pulsar el botón de abajo cada imágenes. Amplía la imagen para ver mejor, basta con hacer clic en la imagen.

Loading...
Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
of vemurafenib complexed to braf is known pdbe 3og7 vemurafenibVemurafenib Structure

of vemurafenib complexed to braf is known pdbe 3og7 vemurafenib

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
Vemurafenib  A First in Class Serine-Threonine Protein Kinase    Vemurafenib Structure

Vemurafenib A First in Class Serine-Threonine Protein Kinase

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
Back to article   Back to figures and tables   Previous figure   Next    Vemurafenib Structure

Back to article Back to figures and tables Previous figure Next

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
braf inhibition and development of vemurafenib a domain structure    Vemurafenib Structure

braf inhibition and development of vemurafenib a domain structure

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
Crystallographic structure of B-Raf enzyme inhibitor  Image courtesy    Vemurafenib Structure

Crystallographic structure of B-Raf enzyme inhibitor Image courtesy

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
Vemurafenib  PLX4032  RG7204  Chemical StructureVemurafenib Structure

Vemurafenib PLX4032 RG7204 Chemical Structure

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
RAS   RAF   MEK   ERK signalling pathway  b   Structure of vemurafenib    Vemurafenib Structure

RAS RAF MEK ERK signalling pathway b Structure of vemurafenib

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
    Right Kinase  Part II     Roche and Daiichi   s Vemurafenib ApprovedVemurafenib Structure

Right Kinase Part II Roche and Daiichi s Vemurafenib Approved

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
Vemurafenib  PLX4032  structure  NCBI imageVemurafenib Structure

Vemurafenib PLX4032 structure NCBI image

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
Targeted Agents for the Treatment of Melanoma  An OverviewVemurafenib Structure

Targeted Agents for the Treatment of Melanoma An Overview

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
synthetic small molecule therapeuticVemurafenib Structure

synthetic small molecule therapeutic

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
weight of 489 9 vemurafenib has the following chemical structureVemurafenib Structure

weight of 489 9 vemurafenib has the following chemical structure

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
figure 4 structures of vemurafenib right and its precursor plx 4720    Vemurafenib Structure

figure 4 structures of vemurafenib right and its precursor plx 4720

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
with representative kinases  The figure shows the co-structure    Vemurafenib Structure

with representative kinases The figure shows the co-structure

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
Vemurafenib Vemurafenib  the first drugVemurafenib Structure

Vemurafenib Vemurafenib the first drug

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
new anti-cancer drug  vemurafenib  is the green honeycomb structure    Vemurafenib Structure

new anti-cancer drug vemurafenib is the green honeycomb structure

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
Vemurafenib  A First in Class Serine-Threonine Protein Kinase    Vemurafenib Structure

Vemurafenib A First in Class Serine-Threonine Protein Kinase

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
The ABC Transporter Mediated MDR Modulated by Tyrosine Kinase    Vemurafenib Structure

The ABC Transporter Mediated MDR Modulated by Tyrosine Kinase

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
BRAFMAALSGGGGGGAEPGQALFNGDMEPEAGAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEALL    Vemurafenib Structure

BRAFMAALSGGGGGGAEPGQALFNGDMEPEAGAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEALL

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
    caption vemurafenib melanoma drug molecular model vemurafenib isVemurafenib Structure

caption vemurafenib melanoma drug molecular model vemurafenib is

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
Targeted Agents for the Treatment of Melanoma  An OverviewVemurafenib Structure

Targeted Agents for the Treatment of Melanoma An Overview

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
Chemical Structure of Zelboraf Vemurafenib BRAF Inhibitor Metastatic    Vemurafenib Structure

Chemical Structure of Zelboraf Vemurafenib BRAF Inhibitor Metastatic

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
The molecular structure of Vemurafenib  a prescription drug used to    Vemurafenib Structure

The molecular structure of Vemurafenib a prescription drug used to

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
CR3   edit  Vemurafenib Structure

CR3 edit

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
Vemurafenib Vemurafenib is approved forVemurafenib Structure

Vemurafenib Vemurafenib is approved for

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
Vemurafenib Could receive vemurafenib Vemurafenib Structure

Vemurafenib Could receive vemurafenib

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
Vemurafenib Of vemurafenib plx4032Vemurafenib Structure

Vemurafenib Of vemurafenib plx4032

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar

Voto positivo
2
puntos
Voto negativo
2 Votos positivos   0 Votos negativos
Chemical Formula  C23H18ClF2N3O3SVemurafenib Structure

Chemical Formula C23H18ClF2N3O3S

Compartir en Facebook
Comments button icon

Publicada hace: 1 mes.

Eliminar esta imagen

Indica el motivo para eliminar esta imagen:

Enviar - cancelar